PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.1597s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 495aa    MW: 55229.2 Da    PI: 9.179
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.1597s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B347.72.7e-1524108999
                          HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                   B3   9 dvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                           +++s+rl +p kf ++++    +++ + l  + g++W+v l   k  ++ ++ +GW +Fvk+  ++ gD++vF+++g+ +f   v +f+
  Kalax.1597s0002.1.p  24 PNSSSDRLEIPHKFHQHIEVR--TNVWVLLSGRGGKVWRVGL--LKLHDTLFFNEGWAGFVKDSFVEIGDILVFEYSGDWQF--EVYIFD 107
                          5678899*******9666644..678899999**********..9********************************98888..888887 PP

                          S CS
                   B3  99 k 99 
                          +
  Kalax.1597s0002.1.p 108 E 108
                          5 PP

2B355.11.3e-17253344196
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                          f++++ + +v   + l +p +f++e++++  ++ +++l++e+g sW+v++    + g+y l +GW+ Fv +ng++ gD++ Fkl++  + 
  Kalax.1597s0002.1.p 253 FITKMQKYNVDFGRVLNIPMQFIRENSLSYLTDEKMVLRTETGSSWSVNI--VANTGGYKLCGGWSAFVIDNGINKGDICEFKLMS--RL 338
                          6677777777788889**********888888999***************..99999**************************986..67 PP

                          ..EEEE CS
                   B3  91 elvvkv 96 
                          e++v+v
  Kalax.1597s0002.1.p 339 EMWVQV 344
                          778887 PP

3B358.89.8e-19399489195
                          EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
                   B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                          f++++ + +v   ++l +p +f++e++++  ++ +++l++e+g sW+v++    + g+y l +GW+ Fv++ng+k gD++ Fkl++r   
  Kalax.1597s0002.1.p 399 FLTKMQRYNVEYGRILNIPMHFVRENSLSYCTDEKMVLRTETGSSWSVNI--VANMGGYKLCGGWSAFVSDNGIKKGDVCKFKLMSR--L 484
                          5566655666666788**********888888889***************..99999**************************9874..4 PP

                          ..EEE CS
                   B3  91 elvvk 95 
                          e++v 
  Kalax.1597s0002.1.p 485 EMRVE 489
                          44554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.5E-2114111IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.04E-2215111IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.22516109IPR003340B3 DNA binding domain
CDDcd100177.39E-1616107No hitNo description
SMARTSM010192.0E-918109IPR003340B3 DNA binding domain
PfamPF023627.5E-1323108IPR003340B3 DNA binding domain
SuperFamilySSF1019361.06E-19247344IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.5E-20247344IPR015300DNA-binding pseudobarrel domain
CDDcd100172.93E-16251344No hitNo description
SMARTSM010193.9E-12253348IPR003340B3 DNA binding domain
PROSITE profilePS5086313.126253348IPR003340B3 DNA binding domain
PfamPF023621.2E-15253344IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.4E-21392490IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.81E-20393490IPR015300DNA-binding pseudobarrel domain
CDDcd100173.36E-17397490No hitNo description
SMARTSM010192.7E-13399494IPR003340B3 DNA binding domain
PfamPF023629.9E-17399487IPR003340B3 DNA binding domain
PROSITE profilePS5086313.437399494IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 495 aa     Download sequence    Send to blast
MATGPPSAVK SVGRKPHFIA TFVPNSSSDR LEIPHKFHQH IEVRTNVWVL LSGRGGKVWR  60
VGLLKLHDTL FFNEGWAGFV KDSFVEIGDI LVFEYSGDWQ FEVYIFDENG CEKEVRDCLG  120
KLGPSLQKKR VRDGDKSSGR VVKKTGSDSC ISNVDCMNHE QEDFFATPCQ PGAPVTEPLA  180
LIIYQEPWSS NLLNGHPTYP HDTTSPSLRE FESAPPGFAQ KHKKSNINRH SKGSTVIRNG  240
PKAVYTSSTI PSFITKMQKY NVDFGRVLNI PMQFIRENSL SYLTDEKMVL RTETGSSWSV  300
NIVANTGGYK LCGGWSAFVI DNGINKGDIC EFKLMSRLEM WVQVTPNPKV ASRTSRNGPL  360
SCPPRNAEVK IRTVKPELEH VIQNALKAAD ASSIGPPSFL TKMQRYNVEY GRILNIPMHF  420
VRENSLSYCT DEKMVLRTET GSSWSVNIVA NMGGYKLCGG WSAFVSDNGI KKGDVCKFKL  480
MSRLEMRVEV TPKL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.14e-19B3 family protein